SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023565 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023565
Domain Number 1 Region: 384-551
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-46
Family SPRY domain 0.0006
Further Details:      
 
Domain Number 2 Region: 17-86
Classification Level Classification E-value
Superfamily RING/U-box 1.43e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 151-214
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000641
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023565
Domain Number - Region: 207-268
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0314
Family HBL-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023565   Gene: ENSONIG00000018718   Transcript: ENSONIT00000023586
Sequence length 564
Comment pep:novel scaffold:Orenil1.0:GL831466.1:12067:16971:-1 gene:ENSONIG00000018718 transcript:ENSONIT00000023586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKWQQQCAVELDLYQFYCSVCLDLLKDPVTIQCGHTYCRSCIEGFWEQEKEKGTYSCP
QCREAFSPRPVLGRNTMLAEVVEKLKRTVTQQARPASPLAPAGPTDIACDFCCGTRRNKA
TMSCLTCLASYCPAHLEPHNSFPVLKLHQLVSATVPLKEKICAKHNKLMEVYCKTDRRCI
CYLCTMDNHWCHSTVSAAAERAAEQVTLSENQSAVKQKSQERQKELNELVQAVKDFKIGC
QTAMKSKDELFDELISSIQKQRTLIKQLIEAREQLAVVRAEALQLQLEEEIARLKKRDAD
LEQLGTKTSHPHFPQLFQSLSISCESPDLPTGVVVRPQRSVETVTDCLTQLRDDMKKLLE
TTWPKISATVFDINVVLPPVPKTREEFLCYHCPLTLDPNSVNKYLDLSQDSQRVTSGYYE
HFHLSHSDRFEGVKQVLCREGLTGRCYWEVSWSGGVWSVAASYKNISRKSFDSEFGKNDK
SWSLECSAKGYTFRHNSVTRAVSGPRTSQIGVYLDYKSGTLSFYSISDTMTLLHKVRTVF
TQPLYPGLGLKELVSGCYSEMKKL
Download sequence
Identical sequences I3KR20
ENSONIP00000023565 ENSONIP00000023565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]