SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023571 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023571
Domain Number 1 Region: 720-944
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-57
Family DBL homology domain (DH-domain) 0.000000196
Further Details:      
 
Domain Number 2 Region: 324-504
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-43
Family Regulator of G-protein signaling, RGS 0.00000221
Further Details:      
 
Domain Number 3 Region: 944-1074
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-27
Family Pleckstrin-homology domain (PH domain) 0.0000289
Further Details:      
 
Domain Number 4 Region: 47-125
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-20
Family PDZ domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023571   Gene: ENSONIG00000018723   Transcript: ENSONIT00000023592
Sequence length 1437
Comment pep:known_by_projection scaffold:Orenil1.0:GL831466.1:149829:177473:1 gene:ENSONIG00000018723 transcript:ENSONIT00000023592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRQPTSTLDRINSLTIGDSERKSSAPQQREPTAEIIPDITGTGLVHRCVIVQKDQLGF
GFTVCGERVKLVQNVRPGGAAVKAGVQEGDRIIKVNGSLVSSMSHQEVVKLIKSGPYVAL
TLQGPSPSTHSLPLEPLQTDLTLNQRASLAGEAAPPPPPPLPSGLSSTPSQRITGPKPLQ
DPQVQKHATQILRKMLEQEEAELQDLMDEQLRNPSPSLEERIESAKRRAHQVRVKIQQDV
EGTRSESVTGYFIAGEGRQSMDSSEGDMEAFESPHSSPSFSFRTPLHRRQWSDISTLSDS
GGKAQIIGPEEEDEEYDGYAFNEMDGPYQDIDLLKTRPAHMAVFMRYVFTQLLDPNPLLF
YLSVEAYLGSLPKDARTLAPQICSLFLEPDAPLKIKVREEYLADIENRLHAQEDIRGPLS
ELQQLVLPEIQDQLQDYRNKQMMGLGSLFGEGDLQHLDGDTVKEKQVVDKQVTALWEILS
KHEEDRSSTLASAVILYLRHSGIKPRDSKVFPGLTTEKDKWITFLKPKKLSGTKKEKDGE
DKKRNPILKYIGKPRTTSQSTFHVPLSPTEVRPGSVRNIIQQFENSTETGEELSDGADPQ
RLSSSSLGDEMDSPLPVRLARSESLKAQGEGRRRGGTSGAESVPRSRSDVDMDDCADERD
GPGLRPLQHSASSSASSNSARSLENPTPPYTPRSRRRSVESPLALLPDVVALEDDVMDSK
TWQETVTPQLLATLSPSEVDRQAVIYELFTTEVSHLRTLRVLDQVFYQKMRTVLTSDELA
CIFPNLPQVYELHASLCEAMKKRRESPIVQDIGDVMLTRFEGAAGDEFQEQASQLCCQQS
QALELIKSKQRKDARFAHIIQECEASPHCRRLQLKDLLVSEMQRLTKYPLLLDKIIKYTE
AGSSDLPLLQRVHTCCRGILQSVNEDVRESEHRQRLSEYQRRLDAAPQFKNVDLTTKRMI
HEGPLTWKVNKEKLIEIQALLLSDCLVLLQKGPDDRLQLRYHSSRLGVSGGGSGDSKTSF
SPLMNLASLLVRPVATDKKALYIISTTDMQIYELVAATTSKKEIWKDLLEKAISAAGGSS
PLMNHSSIPMSSPSLRSSSPVSTGSNAYGDNSMTEQSDSTETHSNNDEPALCHSTPADQS
EAFICGDRQGVAEAALQDVETLRQLILQDFGEDGWSHDSDDTPTNETATESISFTERQRP
ESLETVLSCCTDEWEAEPEELLLAKAPKPSFQVVRKAVVAGPPPSSSSVAEDITDDVTLP
SNQSSKSRSEAKKQGNTFYLVMPIEQGESMTEDLNEPPTPTASHFPPPVEEVTSPQTQME
EEPAARGLEANQSETMQLEQEKETGHLQAAQHTHVIRNVDEIFHTIEELMTKLRHLKEIE
KAHYKLLETLRESSVSQESEDQQCRSATVSRTPSLERSSGDGKEGRPAEPKILSTGF
Download sequence
Identical sequences I3KR26
ENSONIP00000023571 ENSONIP00000023571 XP_019209676.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]