SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024435 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024435
Domain Number 1 Region: 32-499
Classification Level Classification E-value
Superfamily Sema domain 8.37e-129
Family Sema domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 1339-1468,1663-1850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.61e-51
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 945-1034
Classification Level Classification E-value
Superfamily E set domains 5.5e-16
Family Other IPT/TIG domains 0.042
Further Details:      
 
Domain Number 4 Region: 1032-1135
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000121
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 
Domain Number 5 Region: 847-947
Classification Level Classification E-value
Superfamily E set domains 0.000000000000103
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 502-553
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000174
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1133-1223
Classification Level Classification E-value
Superfamily E set domains 0.00000035
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 8 Region: 801-833
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000196
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024435   Gene: ENSONIG00000019413   Transcript: ENSONIT00000024456
Sequence length 1882
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:6344141:6487290:1 gene:ENSONIG00000019413 transcript:ENSONIT00000024456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLERMNCSHWWWLLVIMSSSLSGGQPPPFKRFIPADCSLTHLAIHMKTGEVYVGAVNRIF
KLSSNLTNLRSHMTGPVVDNEKCYPPPSVQSCNHELAQTPNVNKLLLIDYAQNRLIACGS
TSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAESGTMSGVIISSPQSPTSKLFIGTPIDG
KSEYFPTLSSRKLMENEEDADMFSFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFSSE
QFVYYLTMQLDTQLTSPDASGEQFFTSKIVRLCMDDPKFYSYVEFPIGCTKDGVEYRLVQ
DAFLARPGRQLANSLGISENEDILFTVFSQGQKNRAKPPKESALCLFTLRKIKEKIKERI
QSCYRGDGKLSLPWLLNKELACINSPLQIDDNFCGQDFNQPLGGTSTIEGIPLFIDKDDG
MTSVAAYDYRGNTVAFVGTRNGKLKKILVNSINASHPAVLYEKVTVSEGGSPLLRDMLFS
PDQQYIYTLTDRQVVRVPVESCEQYTTCGECLGSRDPHCGWCVLHNVCSRKDHCERAGEP
QRFASDQRQCVELTVQPRNISVTMSEVQLVLQARNVPDLSAGVNCSFEDYVETEGQIQGG
HIFCLSPSARDIAPITRNKGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNG
SFPCHWCKYRHMCTQNANDCSFQEGRVNNSEDCPQILPSTQIYIPVGVTKPITLAAKNLP
QPQSGQRNYECVFHIQGEIHNVPALRFNSTSIQCQKTPYNYEGNDISDLPVDLSVVWNGN
FVIDNPYNIKAHLYKCYALRDSCGMCLKANPRFECGWCVGEKKCSLRQECTPPESTWMHA
TTGNSRCAHPKITKLYPETGPRQGGTMLTITGENLGLQFKDIQNGVRIGKVTCNPQEDEY
ISAEQIVCRLNDATGYRVQEAQVEVCVRECSHPDYKTVSSKAFTFVSPYFTRVHPSTGPL
SGGTRITIDGSHLNAGSAVSVKIGLHPCRFERRNAKEIVCVTPAGQATGETPVMVDINAA
ELRNPDVKFSYTEDPTILKIEPDWSIASGGTKLTITGTNLATIKEPKMRAKYGAAKSENN
CTVLNNTVMVCLAPSVAGSDKSFSDVGSSPDEIGFVMDDVRSLLVVNETFSYHPDPVFEP
LSPTGMLELKPSSPLILKGRNLIPAAPGNAKLNYTVLIGETPCILTLSESQLLCEWPNLT
GEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIVVLIAYKRKSRDA
DRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFP
GIEDHPVLKEMEVPANVEKALTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIM
TALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLK
ECAGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVNPENEN
APEVTVKSLNCDTVTQVKEKLLDAVYKGTPYSQRPKASDMDLEWRQGRMARIILQDEDVT
TKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPD
SLRSRTPMITPDLESGTKLWHLVKNHDHSDQREGDRGSKMVSEIYLTRLLATKGTLQKFV
DDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSISDPDVRHTWKSNCLPLRFWVNVI
KNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKNWVE
RYYSDIARMPAISDQDMSAYLAEQSRLHANQFNSMSALHEIYSYIIKYKDEILSALERDE
QARRQRLRSKLEQVIDTMALTS
Download sequence
Identical sequences I3KTI9
ENSONIP00000024435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]