SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024436 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024436
Domain Number 1 Region: 40-507
Classification Level Classification E-value
Superfamily Sema domain 8.5e-129
Family Sema domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 1347-1476,1671-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.61e-51
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 953-1042
Classification Level Classification E-value
Superfamily E set domains 5.6e-16
Family Other IPT/TIG domains 0.042
Further Details:      
 
Domain Number 4 Region: 1040-1143
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000121
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.065
Further Details:      
 
Domain Number 5 Region: 855-955
Classification Level Classification E-value
Superfamily E set domains 0.000000000000103
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 510-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000174
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1141-1231
Classification Level Classification E-value
Superfamily E set domains 0.00000035
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 8 Region: 809-841
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000209
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024436   Gene: ENSONIG00000019413   Transcript: ENSONIT00000024457
Sequence length 1890
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:6345115:6491515:1 gene:ENSONIG00000019413 transcript:ENSONIT00000024457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHLARSVASSGQGNFLLIGLLVIMSSSLSGGQPPPFKRFIPADCSLTHLAIHMKTGEVY
VGAVNRIFKLSSNLTNLRSHMTGPVVDNEKCYPPPSVQSCNHELAQTPNVNKLLLIDYAQ
NRLIACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAESGTMSGVIISSPQSPTSKL
FIGTPIDGKSEYFPTLSSRKLMENEEDADMFSFVYQDEFVSSQLKIPSDTLSKFPAFDIY
YVYSFSSEQFVYYLTMQLDTQLTSPDASGEQFFTSKIVRLCMDDPKFYSYVEFPIGCTKD
GVEYRLVQDAFLARPGRQLANSLGISENEDILFTVFSQGQKNRAKPPKESALCLFTLRKI
KEKIKERIQSCYRGDGKLSLPWLLNKELACINSPLQIDDNFCGQDFNQPLGGTSTIEGIP
LFIDKDDGMTSVAAYDYRGNTVAFVGTRNGKLKKILVNSINASHPAVLYEKVTVSEGGSP
LLRDMLFSPDQQYIYTLTDRQVVRVPVESCEQYTTCGECLGSRDPHCGWCVLHNVCSRKD
HCERAGEPQRFASDQRQCVELTVQPRNISVTMSEVQLVLQARNVPDLSAGVNCSFEDYVE
TEGQIQGGHIFCLSPSARDIAPITRNKGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQ
SCLSCVNGSFPCHWCKYRHMCTQNANDCSFQEGRVNNSEDCPQILPSTQIYIPVGVTKPI
TLAAKNLPQPQSGQRNYECVFHIQGEIHNVPALRFNSTSIQCQKTPYNYEGNDISDLPVD
LSVVWNGNFVIDNPYNIKAHLYKCYALRDSCGMCLKANPRFECGWCVGEKKCSLRQECTP
PESTWMHATTGNSRCAHPKITKLYPETGPRQGGTMLTITGENLGLQFKDIQNGVRIGKVT
CNPQEDEYISAEQIVCRLNDATGYRVQEAQVEVCVRECSHPDYKTVSSKAFTFVSPYFTR
VHPSTGPLSGGTRITIDGSHLNAGSAVSVKIGLHPCRFERRNAKEIVCVTPAGQATGETP
VMVDINAAELRNPDVKFSYTEDPTILKIEPDWSIASGGTKLTITGTNLATIKEPKMRAKY
GAAKSENNCTVLNNTVMVCLAPSVAGSDKSFSDVGSSPDEIGFVMDDVRSLLVVNETFSY
HPDPVFEPLSPTGMLELKPSSPLILKGRNLIPAAPGNAKLNYTVLIGETPCILTLSESQL
LCEWPNLTGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIVVLIA
YKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRT
YAMRVLFPGIEDHPVLKEMEVPANVEKALTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDR
GNVASLIMTALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFT
FLLYKFLKECAGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLH
CVNPENENAPEVTVKSLNCDTVTQVKEKLLDAVYKGTPYSQRPKASDMDLEWRQGRMARI
ILQDEDVTTKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYESM
LRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHSDQREGDRGSKMVSEIYLTRLLAT
KGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSISDPDVRHTWKSNCLP
LRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDI
PNYKNWVERYYSDIARMPAISDQDMSAYLAEQSRLHANQFNSMSALHEIYSYIIKYKDEI
LSALERDEQARRQRLRSKLEQVIDTMALTS
Download sequence
Identical sequences I3KTJ0
ENSONIP00000024436 ENSONIP00000024436 XP_003441447.2.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]