SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024502 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024502
Domain Number 1 Region: 8-85,112-160
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-18
Family Hormone receptor domain 0.00058
Further Details:      
 
Domain Number 2 Region: 155-426
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000101
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024502   Gene: ENSONIG00000019464   Transcript: ENSONIT00000024523
Sequence length 464
Comment pep:known_by_projection scaffold:Orenil1.0:GL831278.1:1676563:1717696:1 gene:ENSONIG00000019464 transcript:ENSONIT00000024523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLLWFLCDFRLIILTKYIKMKKTNCIFKKGDHTCLLTLLTPLGAITLGCPTVWDNLQCW
YHAEVGQVVNISCASGIWQLLPNNQGWQMEERGLGGHRNADLKQRTQKGVLGYIYRNCTE
KGWSDFYPSYEEACKIPEDEETEPETTYFSNFKQVYTAGYATSLISLISAIFVFTVFRKF
HCTRNYIHMNLFFSFILRASAVFIKDAILFSDENMDHCFMSTRSCKSAVAFFQFSILANY
FWLLVEGMYLQTLLTLTFVFQKKYFWWYILIGWGLPTVIITAWILTRNFYDNRGCWDDTD
VAFIWWIIKAPITASLLVNFVIFINVIRILVQKLRSPGVGGNDTSHFKRLAKSTLLLIPL
FGMHYMVFAFLPENTGTEARIFIELGVGSFQGFVVALLYCFLNGEVQAELKKRFWKWQTQ
SYLSYSKRRRTLFTESSTITQISVLDKSSPKDRPGSETRALTNT
Download sequence
Identical sequences I3KTQ6
ENSONIP00000024502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]