SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024589 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024589
Domain Number 1 Region: 372-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-43
Family SPRY domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 137-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000397
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024589   Gene: ENSONIG00000019534   Transcript: ENSONIT00000024610
Sequence length 551
Comment pep:novel scaffold:Orenil1.0:GL831171.1:1825676:1835099:-1 gene:ENSONIG00000019534 transcript:ENSONIT00000024610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKGAQLNREISCSICLDLLKDPVTIPCGHNYCMNCIKTHWDEDERRMHSCPQCRQTFT
PRPALVKNTIMAHLVEEIKKTAAPADHCYARPEDVPCDVCTGRKLKAFKSCLFCVASYCE
KHLQHHYNAAPLKKHKLVEPCKKLQENICSSHDELMKIFCRTDQQRICSHCKLDGHKYHE
TVPVEAERTKKQKELEMSRQKLQQRLCDREKDVTILQQEVESINQSADKAVEENEKIFAE
LICLMQNRSSDLKQRIRSQQETEVGRVKELQEKLEQEIAELRRNDAELEQLSCTEDHNQF
LHSYSSLSALNESTDSSSIEIRPLRYFEDLTAAVKKVSDKLQDILKEKWTNISLTVTEVD
VLLSQPVPKTRGGFLRYSREIRMDLVAANTSVLLCEGGRKATAVKEQQSYSSHPDRFSGW
CQVLSRESLTGRCYWEVEWSGKQVYIAVTYKSTSRSGLSNECGLGFNRTSWALCCDQNGF
KFVHNNSHKAVSGPQFGKVGVYLDHSAGILCFFSVSETMTLLHRVQTTFTQPLHAGFRLS
DYGDTAEFRKL
Download sequence
Identical sequences I3KTZ3
ENSONIP00000024589 ENSONIP00000024589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]