SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024780 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024780
Domain Number 1 Region: 802-991
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.18e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000986
Further Details:      
 
Domain Number 2 Region: 503-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-44
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 3 Region: 38-423
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.1e-41
Family L-arabinose binding protein-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024780   Gene: ENSONIG00000019687   Transcript: ENSONIT00000024801
Sequence length 1077
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:4830701:4847895:-1 gene:ENSONIG00000019687 transcript:ENSONIT00000024801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGSWLLCLFTFGILVASCPSVGQCGSGITINVILLDDEDSPWSLQYVEGQILKAIEKD
SAINAAQDPAVTFNLTANFSGFDTNLYWHRGCRSSSCEAVAELNNLTESGNLGCAVLGPT
CTYVTFPIVDKEAGMSLSRPILSAGSFGRSCDYTFNLQRLLPPARKIADFVDHFWKENNE
LKPSWKTAYIYKKTNPTEECVWYVSAIEATVEPLALNVSIIPLRSPAELHSVLTLPNRTC
NLFIMCGSPMDLVEIKNGSKAADSSDIVFILIDLYSDVYYTNASSLPEMKNVLVLTMPNT
RSYRINPNLQDNNTMNDYMAAYHDAVLFIGQVMRTISKQNQSQLHRTEYVNVNYFRNTKF
TGIAGEYALDEYGDRDVAFSIIYTTSDNKYDILFTFDTARYKTTVVEEAPKFIWGKRLPN
TTPDSGPAIHTIIVIVLGVTVVVVATIAFIFYRQNRRDRLLRKRWSHVNSDLITLMENDD
INVISLNIESKKKKKIKIRCALYDKKIVILKELKNSDGNFDETQKRELNALLHIDYYNLT
KFYGTVKLDHGVFGVFEYGERGSLKYVLNDKISYPEETFMDWEFKISVMYDIAKGMSYLH
ASDIQVHGRLKSTNCVVDNRMVVKITDFGCNAFLSPFQDLWTAPEHLRNQGMSQKGDIYS
FAIIAQEIVLRKNTFYTESCSDRSEKLSRLMTSYFRPDLNFETASEKELEVYTLIKSCWD
EDPEKRPDFKKVEIYLGKIISKIHNQENESYLDNMIRRLQMYSRNLEYLVEERTALYKAE
RDRADNLNFMLLPCPVVKSLKETGAVEPELYDEVTIYFSDIVGFTTLCQYSTPMEVVDML
NDIYKGFDSIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAVDICRMALDILAFMGTFQL
RHLPGIAVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGHPLRIHVSQPTI
DILERTNCKFEYEMRGETNLKGKGTETTYWLTGETGEDYDLPTPPTTENVQRLQQDLAHM
ILTCLERRSRGSVRRKKLLPSQSKEDTSDQGSEVESESSLPEYLHLATVDNTLSTFL
Download sequence
Identical sequences I3KUI4
XP_005448102.1.78416 ENSONIP00000024780 ENSONIP00000024780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]