SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025098 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025098
Domain Number 1 Region: 352-535
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-65
Family SPRY domain 0.00000889
Further Details:      
 
Domain Number 2 Region: 135-195
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Domain Number 3 Region: 12-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000115
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025098   Gene: ENSONIG00000019925   Transcript: ENSONIT00000025119
Sequence length 540
Comment pep:novel scaffold:Orenil1.0:GL831388.1:895914:898733:-1 gene:ENSONIG00000019925 transcript:ENSONIT00000025119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSFRLSEVQFQCSICQDVFSEPVSIPCGHSFCFTCITTHWDVSRAISCPRCHTVFEC
RPELCENSFAKEMSEQIRARRQNGVIAVTEKVIYCDVCTGTKTQALKSCLTCLTSYCEMH
LEPHLRVATLKIHKLIEPVAMLQNRMCKKHQRLLELFCRSDQRCVCVLCTETDHRSHKTV
PVERESQERKVQMKRIEVDVQQMIQDRLQKVEEIKRCVELSKVNSKRDIEKSVQVFSALI
RTMERSQAELVEMIQRRQAAAEQRADRLVAELELEITELQRRRSEMEQLFHTDDHLHLIQ
RFPALSSLPSARSCSEIIVHADTSLGILRRAVFSIEQQLQSELKKLSIQEHEKIQQYAAD
VQLDPRTANPWLVLSGDGRQVWDGNVEQNLADIPERFDTAPCVLALKGFTTGRHYWEVDV
GDKTAWDLGVAKESVNRKGLVTLCPEDGYWTICLRKGSEYRACAGQAELLSLAQRPRIVG
VFLDYEEGRVSFYNADTQSHIYSFTHGRFTDAMLPFFNPDMSDNGSNKSPLIIRQVSGID
Download sequence
Identical sequences I3KVF2
ENSONIP00000025098 ENSONIP00000025098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]