SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025736 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025736
Domain Number 1 Region: 365-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-64
Family SPRY domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-20
Family RING finger domain, C3HC4 0.0057
Further Details:      
 
Domain Number 3 Region: 144-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000336
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025736   Gene: ENSONIG00000020431   Transcript: ENSONIT00000025757
Sequence length 550
Comment pep:novel scaffold:Orenil1.0:GL831258.1:1877238:1878890:-1 gene:ENSONIG00000020431 transcript:ENSONIT00000025757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAGSVLSKEQLLCPICLDLFNQPVSTPCGHNFCRECLQRYWQSSNMPQCPMCKHKLYM
RPDLKVNTFISEVASHFKELVEKKNENESSGMDQSEGHKGEVSCDVCIGKTVKAFKSCLD
CLASFCETHLEPHHVLGTFKKHRLIKPMINMQDRVCKQHEKLLDLFCNTDQVYVCQICIT
KDHTAHQTVRIVDESRNRRAQIGSTKKEVGEMIHRRLQKICDINKIIQISRRNTERETEE
SLRVFSKLFQLVQRGQAEVAEVIGAKQKQVESMASRLILELEQEIDQLSCRRDELEQLSF
TDDDLYLLQYFPAFATMPATKDWSDTCLESTEYVGIVRRAVRRVMCQLEETVKAEVKRLC
ESEFQKAQQYAVDVHLDPDTAHPKLVLSENKKQVYHGDVSLSLPDNPERFYPCVSVLGKE
GFSAGRFYYEVEVKGKTEWDIGVALETVTRKGGNMLNPDRGYWALGMRKDESYWALSNSP
VCVPLIEKPQRIGVYVDMGWGQVSFYDVDSHCHIYSFTGCTFSSRLLPYFNPRRNHGGVN
SAPLIILPVN
Download sequence
Identical sequences I3KX90
XP_005457929.1.78416 ENSONIP00000025736 ENSONIP00000025736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]