SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025784 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025784
Domain Number 1 Region: 372-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-45
Family SPRY domain 0.0009
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-18
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 138-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.8e-16
Family B-box zinc-binding domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025784   Gene: ENSONIG00000020479   Transcript: ENSONIT00000025805
Sequence length 560
Comment pep:novel scaffold:Orenil1.0:GL831220.1:2765492:2767174:1 gene:ENSONIG00000020479 transcript:ENSONIT00000025805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQLDQEKLCCSICLDLLKEPVTIPCGHSYCMSCIESRWTEEEHNKSYSCPHCKQTFAP
KPDLVKSAMFADLVEALKTRLKFAPADHCYAKPGDVACDFCTDKKLKALKSCLVCRISYC
ELHLQPHYESSAFEKHKLVEPLKNLQEKFCSHHDEVMKIFCRTDQQAICFLCSVDEHKNH
DTVSAKAERNSKQMKLGVSREKIQMRIQNREKDLKVLQEEIEAINFSADKIVKDSKKIFT
ELVCLVEKMSSALNEQIRFRQKAEVNRVTELKEKLEQEIAELWVKDAELELLSTTDDHIQ
FLLNYPSLSHLSESTDLPSSDVHPPLYFEHVTVALSEIRGKLENVLNEEWTKISLKVTEV
DVLLPIPEPETREEFLQYSRKITLDPQTVNPWISLSEGNTKATVMKEKQIYDCHPDRFTH
WLQGLSKESLIGRCYWEVERSAGGILVAVAYKDISRTGNESGFGNTDKSWALGCFDFNYY
FRHNNMKTLLSGSQMPKIGVFLDHRAGTLSFYGISEEMILLHKVQTKFSQPLYAGVSVYW
AGDTAKLCKLQSTWSKEVDG
Download sequence
Identical sequences I3KXD8
ENSONIP00000025784 ENSONIP00000025784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]