SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025825 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025825
Domain Number 1 Region: 356-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-55
Family SPRY domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 10-75
Classification Level Classification E-value
Superfamily RING/U-box 8.72e-19
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 3 Region: 140-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-16
Family B-box zinc-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025825   Gene: ENSONIG00000020520   Transcript: ENSONIT00000025846
Sequence length 543
Comment pep:novel scaffold:Orenil1.0:GL831167.1:1699801:1701432:1 gene:ENSONIG00000020520 transcript:ENSONIT00000025846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASSLLSEERFLCCICLDVFTEPVSTPCGHNFCRPCIHKYWDTSDVCQCPFCKRTFSS
RPELNVNTTMSELAAEVAKLVQVKVSTSDRELPEGTNVLCDICTGMKEKAVKSCLMCLTS
FCVVHLEPHQRVSVLKSHKLIDPVINLDERMCKKHNKITELYCRTDKACICVLCFKSDHK
SHNVISLEEEYEAVLAKNDEVMANIHKMIQSRCDKIDAIEKSLDASQKEADEEKEASVQM
FTDFIRSIQKSQADVVEVIEERHRAMKQKAEGFLKEMRMEVAELKSRRSQLEQLSRSEDH
HCLVQNFSSLCAPSSKDWSNADVYSNLSFNQVRRAMAQVKQAADNILEKVPEIKMKRMRE
HAVDLTIDPDTAHCSLTISQDRKQVGTAEKQNLPKNPKRFEMYPEVLAKEGFTEGKFYFE
VQVKDKSKWTVGVVRESVDRKGDTRLSVSDGYWTIGLNEGKYYGYENLAVILVQLKKLQK
VGIFVDYDKGVVSFYDVDSKSHIYSFSGYRFKDKLYPYFCPHYNTDKMNVAPLVITPVPH
RLA
Download sequence
Identical sequences I3KXH9
XP_005451675.1.78416 ENSONIP00000025825 ENSONIP00000025825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]