SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025864 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025864
Domain Number 1 Region: 373-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-49
Family SPRY domain 0.00066
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 1.15e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 140-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.36e-16
Family B-box zinc-binding domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000025864
Domain Number - Region: 237-363
Classification Level Classification E-value
Superfamily t-snare proteins 0.0706
Family t-snare proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025864   Gene: ENSONIG00000020559   Transcript: ENSONIT00000025885
Sequence length 553
Comment pep:novel scaffold:Orenil1.0:GL831235.1:1581992:1583650:-1 gene:ENSONIG00000020559 transcript:ENSONIT00000025885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQLIQLDQEKLSCSICLDLLKDPVTIPCGHSYCMDCIKNCWDEKETHSCPQCRQTFTP
RPVLVKNMILGELVEDLKKAEHSTASSDHAYAGPGDVACDFCSERKLKASKSCLMCMASY
CEHHLQPHYNIAPLKKHKLIKATSKLQENICPHHDEVMKIFCRTDQQCICYLCLMDEHKD
HDTVSAAAERAEKQKELETNRQNVQQRIQNREKDVKVLQEQVEAINLSADKAFRECDKAF
KNLISLIEKKSSEVKQKIRSKQNAEQNRVKELQEKIEQEIRDLRRRDTELQQLSLTEDHL
HFLNNYSSLSHLRASTNVPTYNKLTLQYFEDVTAAVSQARDKVKALLSDEWPQTSFSMTK
ADVLLPQGEPKTRGEFLKYFCQITLDVDTAYTHLSLSDSNRKVTLMSRNQSYPSHPDRFF
ERWQVLSREGLTGRCYWEVKCNGTVGVAVAYKDIGRRGTREECGFGWNDKSWSLRCSNNG
YEFKHNNISTSISRPLSSRIGVYLDHSAGTLSFYSITETMNLLHRVLTRFTQPLHAGFWL
PQSAGDTAELLEF
Download sequence
Identical sequences I3KXL8
ENSONIP00000025864 ENSONIP00000025864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]