SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025949 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025949
Domain Number 1 Region: 362-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-62
Family SPRY domain 0.00000786
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-19
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.39e-17
Family B-box zinc-binding domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025949   Gene: ENSONIG00000020644   Transcript: ENSONIT00000025970
Sequence length 596
Comment pep:novel scaffold:Orenil1.0:GL831292.1:892456:894246:-1 gene:ENSONIG00000020644 transcript:ENSONIT00000025970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLLSEDQFLCSICLDVFTDPVSTPCGHNFCKNCISQHWDISDRCQCPMCKKVFET
RPEPHIKTLMSEMISQFRHEAQHKVNSSNSEQQAAKPGEVPCDICTGTKLKALKSCLVCL
ASYCQTHLEPHLAASRLKRHQLIDPEENLEGRMCMKHNKPLELFCKTDQTCVCVLCSVID
HKTHEFVPLREEYEGKKAELGKTETEIQQMVQKRRLKIQEIKESVKMSKDAADREKAEGV
QVFTALKESVDRRLNELVKQIEDKQETTEKQAQGFIKDLEQEISELMKRSSEVEQLSCSK
DHLHLLQRFSSLKAAPTTKDWTEVSIHPPSYEGTVVRAVVRAVDQLKETLSKDMKNLFDA
ELKRVQQYAVDVTLDPDTVNHHLILSDDGKQVHCGEEENDLPDNPKRFSEELVALGKQSL
SSGRFYFEVQVKEKTEWALGVVRESVNRKQEITPSPEKGYWTVGVYENICVALEDPEVRL
LLQSYPEKVGVFVDYEEGLVSFYDVDCAVLIYSFTGCSFTGKLYPFFCPGVNDDDDNSAP
LIICPVNQSVQSFSMGNVDQSKFKPSQRRSPKNRTQQNAPDEDHEIQSEAAEQADL
Download sequence
Identical sequences I3KXV3
XP_013132652.1.78416 XP_019207794.1.78416 XP_019207795.1.78416 ENSONIP00000025949 ENSONIP00000025949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]