SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025966 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025966
Domain Number 1 Region: 373-558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-45
Family SPRY domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 10-77
Classification Level Classification E-value
Superfamily RING/U-box 6.86e-18
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000687
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025966   Gene: ENSONIG00000020661   Transcript: ENSONIT00000025987
Sequence length 572
Comment pep:novel scaffold:Orenil1.0:GL831148.1:308906:310624:-1 gene:ENSONIG00000020661 transcript:ENSONIT00000025987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSSIFSEDQFLCPICLDVFTRPVSTPCGHNFCMLCIKTYWNDVQVCRCPVCNHTFER
RPDLKVNTFISELASNVLSLKGKVFDTWSAHSLQASPGAVVLCGICTDTPQEAIKSCVEC
QTSYCDVHLAPHHLAPGLKKHTLIEPVASLEGRICEEHNRLLMWFCRDDSALLCDVCSSS
HHKEHSVVPVEQAYDEKKSLLEHTEGKVQRMIQERLQNVVKVKESVKLSKTETEKVIASG
MQDLTDLVSEIQRSQTELIAVIEEKQKTVEQKAGGVISDMEKEITELQLTSVKLTELKQT
KDQLHFLRHYPNSSVLPQTIDLLNLSFNRHLEIQHVGEYLRNSVSQLRTLLNKMNTDIQK
LCDSSDVSNKATLRYMQQYEVNVLLDPDTAHPLLMISDDLKEVRYSMRTGWWANQISNPN
MFTEHLAVLGNRSFSSRKLYFEVYVGQKTEWCLGMAAASVQRRGSLSRDSRSGLWAMWFL
ENKFETFNSPDEPVHFGKVERIGVFMDYDRGQISFWDTEAATLIYSFSECFFTEELYPYF
NPCDNEFGSNLDPIIIVPVGESESAGLQRLTL
Download sequence
Identical sequences I3KXX0
XP_005471514.1.78416 XP_019217992.1.78416 XP_019217993.1.78416 XP_019217994.1.78416 ENSONIP00000025966 ENSONIP00000025966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]