SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025973 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025973
Domain Number 1 Region: 359-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-68
Family SPRY domain 0.00000388
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-21
Family RING finger domain, C3HC4 0.0078
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025973   Gene: ENSONIG00000020668   Transcript: ENSONIT00000025994
Sequence length 552
Comment pep:novel scaffold:Orenil1.0:GL831576.1:8494:10152:1 gene:ENSONIG00000020668 transcript:ENSONIT00000025994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASNLRSEDQFLCSICLDVFTDPVSTPCGHNFCKTCISQHWDMNQSCQCPMCNETFYT
RPQLRVNTFISEMVAQFRREAQQKASSSSSEQQAAKPGEVPCDFCTGTRLKALKSCLVCQ
TSYCQTHLEPHLTVKRLKRHQLIDAVENLEGRMCTKHDKLLELFCKTDQTCVCMLCSVLD
HKNHEFVPLREEYEGKKAELEKTEAEIQQMIQKRRLKIQEITGSVKMSKDAADRQKAEGV
QVFMALKESVERRLKELIKEIEDKQETTEKQAEGLIKDLEQEISELMERSSEVETLSRSK
DHLHLLQSFSSLKAAPPTKDWTEVRVHPPSYEGTVVRAVAQLEETVWKDMKKKLFEAELQ
RVQQYEVDVTLDPDTAHPALILSDDGKQVYHSDVRKNLPDNPERFSPCVCVLGEQSLSSG
RFYFEVQVKGKTEWDLGVATESINRKGNITLRPQDGFWIARMRNGNEYKARASPSVPLCL
HPGPEKVGVFVDYEEGLVSFYDVGAAALIYSFTGCSFTHKLHPYFSPCLNYGGKNSAPLI
ICPVNQTESIND
Download sequence
Identical sequences I3KXX7
ENSONIP00000025973 ENSONIP00000025973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]