SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025981 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025981
Domain Number 1 Region: 503-830
Classification Level Classification E-value
Superfamily L domain-like 2.62e-44
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 2 Region: 33-432
Classification Level Classification E-value
Superfamily L domain-like 5.27e-38
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 3 Region: 888-1041
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.23e-35
Family Toll/Interleukin receptor TIR domain 0.000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025981   Gene: ENSONIG00000020676   Transcript: ENSONIT00000026002
Sequence length 1055
Comment pep:known_by_projection scaffold:Orenil1.0:GL831311.1:1118572:1121739:-1 gene:ENSONIG00000020676 transcript:ENSONIT00000026002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSHFSVQMCVALLTLWSCLPILATGIYYPKTLPCDVNEINNGSEVRVDCTERNLKKIPHG
IPRDTTNLTLTINHIPSLNSTSFHGLENLTEIDMRCNCVPIKIGPKDKMCLKSVTIEENT
FSRLSNLRALYLDGNQLYSIPKGLPSNLILLSLEVNHIYYLSKANLSELRNVEVLYLGQN
CYFRNPCNDSYDIEDDAFLQFNNLKLLSLKSNNLSFIPHQLPTTLKELYLYNNNIQEVTD
EDFKNLTNLEILDISGNCPRCYNAPFPCSPCPNNAPLKISKTAFKMLTKLKTLRLHSNSL
TSVPSEWFDTTTELRVLDLSSNFLARELEITAFPKFLGKLEELDLSFNYELQKYPQTLRL
SCSFSSLKSLKIFRMKGFVFQQLTTESIAHLKPLPNLEVVDLGTNFIKMTKLSILMELKS
FKIISLSDNKISSPSDGRDALGLSGGETSDWSPMSSAAEYQNKEVREIHYFRYDEYARSC
KYKDKELGVITSFVKKECSQFGKTLDVSRNNIFFLHSRFLNLTELRCLNLSGNAMSQSLN
GSEFTYLANLQYLDFSWNRLDLLYSTAFQELKNLVILDISNNNHYFESEGLTHMLNFTRN
LKNLKVLLMNHNKISTSTNTELESQSLERLEFRDNRLDVLWRDGNTRYVNYFKNLVNLTV
LDISHNNLPFIPSDVFSGLPEKLSELYIKNNKLKSFNWNKLQLLHSLRVLDLSGNSLTTV
PHVLSNCTTSLEKLILHKNQILKLTPDFLKGAYHLKYLDLSFNHIQYIEKSSLPDDVLNH
MDMLLLHKNRFLCTCNATWFVTWLNRTTVTIPKLGTDVTCVAPGAQRGRPVVSVDLLACQ
HHYLSIILSTLMTSLVLILVTLSISSHLFLWDVWYIYHFCRAKLKGYRRLYSQSAVYDAF
VIYDKEDPAVSEWVTKEMCAHLEECGDRRLTLCLEDRDWMPGCPLIDNLSQSIHRSKRTV
FILTKKYIKGGNFKTAFYMAHQRLMDEKNDVIVLIFLEKVPCNSKYLRLRKRLYKRSVLE
WPTNPQAQPYFWFSLRSVLATEGHKQYNNLFKETL
Download sequence
Identical sequences I3KXY5
ENSONIP00000025981 ENSONIP00000025981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]