SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026106 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026106
Domain Number 1 Region: 359-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-66
Family SPRY domain 0.00000345
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-21
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.5e-17
Family B-box zinc-binding domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026106   Gene: ENSONIG00000020802   Transcript: ENSONIT00000026128
Sequence length 559
Comment pep:novel scaffold:Orenil1.0:GL831586.1:28185:29864:-1 gene:ENSONIG00000020802 transcript:ENSONIT00000026128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASNLRSEDQFLCSICMDVFTDPVSTPCGHNFCKICIKQHWDMNQRCQCPMCKETFYT
RPQLRVNTFISEMVAQFRREAQQKASSSSSEQQAAKPGEVPCDVCTGTRLKALKSCLVCQ
TSYCQTHLEHHLTKEALKRHQLIDAMENLEGRICTKHGKPLELFCKTDQTCVCMLCSVLD
HKNHEFVPLREEYEGKKAELEKTEAEIQQMIQKRRLKIQEITESVKMSKDAADRQKAEGV
QAFTALMESVERCLKELMKEIEDKQEATEKQAEGLIKDLELEISELMERSSKVEQISCSE
DHLHLLQSFSSLKAAPPTKDWTEVRVRPPSYEGTVVRAVAQLEETLGKDMKKKLFEAELK
RVQKHEVDVTLDPDTAHPYLILTDDGKQVRDSDVRKNLPDNPERFSHCACVLGEQSFSSS
RFYFEVQVKGKTDWTLGVATESINRKGKITLSPQDGFWTVMLRNGNKYKANAGHPVPLCL
HPGPEKVGVFVDYEEGLVSFYDVGAAALIYSFTGFSFTHKLHPYFCPCNNDGGKNSAPLI
ICPVNQTESILFDELIDFY
Download sequence
Identical sequences I3KYA9
ENSONIP00000026106 XP_003459640.1.78416 ENSONIP00000026106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]