SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026231 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026231
Domain Number 1 Region: 359-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.88e-67
Family SPRY domain 0.00000371
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 9.77e-21
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.4e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026231
Domain Number - Region: 206-306
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0562
Family Oxygen-evolving enhancer protein 3, 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026231   Gene: ENSONIG00000020928   Transcript: ENSONIT00000026254
Sequence length 552
Comment pep:novel scaffold:Orenil1.0:GL831474.1:129697:131355:1 gene:ENSONIG00000020928 transcript:ENSONIT00000026254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASNMRSEDQFLCSICLDVFTDPVTTPCGHNFCKTCISQHWDTNQRCQCPMCKETFYT
RPQLRVNTFISGMVTQFRREVQQTASSSSSEKQAAKPGEVPCDFCTGTRLKALKSCLVCL
TSYCQTHLEPHQTKEGLKRHQLIDAVEKLEGRMCTKHDKLLELFCKTDQKCVCALCSVLE
HKNHKVVPLKEEYEVKKAELGKTEAEIQQMIQKRRLKIQEIKESVKMSKGAAHRQKAEGV
QIFNALKKSVERLLKELIKEIEDKQETTEKQAEGLIKELEQEISELMERSSKVEQLSCSE
DHLHLLQSFSSLKAAPPTKGWTEVRVRPPSYEGTVGRAVAKMEETLWKPMKKKLFEAELK
RVQQYAVDVTLDPDTAHAKLILSDDGKQVYHRDVKKKLPDNPGRFSYCAMVLGEQSFSSG
RFYFEVQVKGKTEWTLGVARETINRKGKITLSPQNGFWTVWLRNGNEYSACDNSLVRLCL
HPGPEKVGVFVDYEEGLVSFYDVGAAALIYSFTGYSFTQKLHPFFEPCLNDGGKNSAPLI
ICPVNQTESIND
Download sequence
Identical sequences I3KYN4
ENSONIP00000026231 ENSONIP00000026231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]