SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026324 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026324
Domain Number 1 Region: 376-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-39
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 2.03e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-17
Family B-box zinc-binding domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026324
Domain Number - Region: 199-303
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0418
Family HBL-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026324   Gene: ENSONIG00000021021   Transcript: ENSONIT00000026347
Sequence length 559
Comment pep:novel scaffold:Orenil1.0:GL831391.1:794:2470:1 gene:ENSONIG00000021021 transcript:ENSONIT00000026347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTHQGQTMDQEKLCCSVCLDLLKDPVTIPCGHNYCMSCIRVHWNKEDPKGIYSCPQCRKI
FIPRPALVKNTMLAELVEDLKTPGIQPASADLCYAGPEDISCDVCTGKKLKAVKSCLVCL
VSYCEQHLQPHYDSSAFDSHKLVKPSNRLKGNICSTHNEVMKMFCRTDQKCICYLCCVNE
HKDHNTVPVEEERIEMQKEFEVILQNVQRRIQTREGEVNMLRKEIEEILQSSDSVAKDIE
TIINELVSFIKEKGSNLKQQIKSEQKTEERRVSELQNKLKQEITELKRQEEELKQLSFTE
DHIEFLRIYSQMPKLTDSTDSPTFRICPVKYLEDLERAMSEARDKLKMFVSEEWSKLTLR
VRSADVLLPQAQPKTRDEFLKYSRQLTMDPDTVHRKLFLSNQNRTVSDNAPYPCKNSGLK
KRDRFNIEQQVLSKESLIGPCYWEVEWKGEGVSVAVSYKNEIRLDQSAFGSNNTSWALEC
YNKSYKFKHNNITTPVSGPLSSKVGVYVDPRAGVLSFYSISDTMALLYRLQTPFTAPLYA
GLWIWKTYWTDTTATFNEL
Download sequence
Identical sequences I3KYX7
ENSONIP00000026324 ENSONIP00000026324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]