SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026354 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026354
Domain Number 1 Region: 362-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-45
Family SPRY domain 0.00098
Further Details:      
 
Domain Number 2 Region: 128-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000353
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026354
Domain Number - Region: 271-307
Classification Level Classification E-value
Superfamily Transposase IS200-like 0.0131
Family Transposase IS200-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026354   Gene: ENSONIG00000021051   Transcript: ENSONIT00000026377
Sequence length 536
Comment pep:novel scaffold:Orenil1.0:GL831141.1:2596955:2598562:1 gene:ENSONIG00000021051 transcript:ENSONIT00000026377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDKLCCSICLDHLKDLLTIPCGHDYYMNCIQIHWDKEDQKETHSCPQWRQTFAPRPDLGK
NTMLGESVEDLKKTSVSASTELEDVSCDVCTERKVKAVKSCLQCLVSYCEQHLQPHYESL
AFEKHKLVDPCQKLDDHVCSHHNEVIKIFCRTDQQCICCLCSKDEHEGHDTVSALTERKE
KQTELGVSQQNIQQRIKEKEKDMKVLQQEVEAINQSADKAVRDNEKVFNDLIQLIKKRSS
NLKQQIRSKQKNELNRVGELQEKLQQELAELKRKGAELEQLSGTQDHIHFLHSYPLLSSL
SESTNSLSINIRSPCYFDDVTAAVSEVRKKLENTIKLEWTKISLKVTSADFLLLPEPEPK
TRADFLQYSRQITLDLNTAHPQLILSEGNRIARLTIKKQLYPDHPDRFTQRQQVLSRESL
TGRCYWEVEMGPASATVAVTYKDISRTGDESEFGCNDRSWALENSVEFIHNSMNNTISGP
RSSRIGVYLDHSAGVLSFYWISKTMTLLHRVQTTFSQPLYAGLSVYGCGNSLKLCE
Download sequence
Identical sequences I3KZ07
ENSONIP00000026354 ENSONIP00000026354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]