SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026356 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026356
Domain Number 1 Region: 376-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-45
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-19
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000534
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026356
Domain Number - Region: 113-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0251
Family FCH domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026356   Gene: ENSONIG00000021053   Transcript: ENSONIT00000026379
Sequence length 540
Comment pep:novel scaffold:Orenil1.0:GL831141.1:3100368:3101987:1 gene:ENSONIG00000021053 transcript:ENSONIT00000026379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQGVQIDGDKLCCSICLDLLKDPVTIPCGHSYCMNCIKRHFDEEDQKNIHSCPQCRQT
FIQRPVLKKSTMLAELVEELKKTGLYAVPADYCYAGPGDVACDVCTGRKLKAIKSCLQCL
VSYCEQHLQLHHNVDALKKHKLVDPSEKLQDTICSHHNEVMKIFCRTDNRCICYACSIDE
HKAHETVPASAERTQREKELNPCREKIQQRIENRKKDVNLLQQEVEAVNQSADKAVRDTE
KIFSELILLIEKRSSDMKQQIRFEQETEINRVNELLEELEEELNELKRKDTELEKLSHTE
DHTQFLNMFPLLSDLNESSESRCPTARPLLYFGDVPAAVSEVKDKLQGVLQKGWQKVSRT
VINVDVLLPQPEPKTRAEFLKFSTQLTLDPDTVNMRLLLSEENRRATFVNKKQAYPGHPE
RFTNRSQVLSRESLTGRHYCEVEWSGFGIYVAVAYKSIMRTGDESEFGNNDKSWALRCSS
SHYELSHKRVCEWLSGPQSSRIGVYLDHTAGVLSFYSVSDTMTLLHRVQATFTQPLYAGL
Download sequence
Identical sequences I3KZ09
ENSONIP00000026356 ENSONIP00000026356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]