SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026357 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026357
Domain Number 1 Region: 376-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-45
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-20
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-17
Family B-box zinc-binding domain 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026357
Domain Number - Region: 199-308
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0534
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026357   Gene: ENSONIG00000021054   Transcript: ENSONIT00000026380
Sequence length 557
Comment pep:novel scaffold:Orenil1.0:GL831141.1:3113175:3114845:-1 gene:ENSONIG00000021054 transcript:ENSONIT00000026380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEGFKIAGNKLCCAICLDLLEDPVTIPCGHNYCRDCIKIHWDGQDQKHIHSCPQCRQT
FIPRPALVKNTMLAELVEEVKQTGLYAAPADYCYAGPEDVACDVCSGRKLKAFKSCLHCV
VSYCERHLQPHHKVDGLKKHKLVNPFKNLQENICPHHNEVMKIFCRTDQQCICYLCSMDE
HKGHDTVPASVERTEKQKELKPCLEKFQLRIQDREEHVKVFLQEMEAINQSADKAVRDTE
NTLQQLFLLIKKNISDIQQQIRSQQKTEVKRAKQVVEKLQEELSELKRKYAELEQLSHTE
DHTQFLHMFPLFSNLTESTEVPFTKRHPLLYFDDVPPAVLEVKNKLQDDLQEGWQKVSRT
VTDVDVLLPQPEPTTRAEFLKFSTQLTLDPDTVNMRLLLSEENRRVTFVSKKQAYPGHPE
RFMNRSQVLSRESLTGRHYWEIEWSGFGIYIAVAYKSISRTGDQSEFGNNSESWALECYS
GNYSLSHDKNCYRFTGPESSQIGVYLDHRAGILSFYNVYSVFDTMTLLHRVQTAFTQPLY
VGLRASHFLGSDSSAVF
Download sequence
Identical sequences I3KZ10
ENSONIP00000026357 ENSONIP00000026357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]