SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026358 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026358
Domain Number 1 Region: 360-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-40
Family SPRY domain 0.0015
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-20
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 140-204
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-16
Family B-box zinc-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026358   Gene: ENSONIG00000021055   Transcript: ENSONIT00000026381
Sequence length 523
Comment pep:novel scaffold:Orenil1.0:GL831141.1:3136093:3137661:-1 gene:ENSONIG00000021055 transcript:ENSONIT00000026381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTNRLDEKKICCSICLDLLKDPVTIPCGHSYCMNCIKSYWDEEDQKNIQSCPQCRQTFIP
KPALKKNTVLAELVEELQKTELQASPADHGYAGPEDVACDVCTGRKLKAIKSCLQCLVSY
CEQHLQPHYDSTAFEKHKLVDTSKRLKRIICSQHSEVMKIFCRTDQQCICYLCSMDEHKG
HDTVSATAERNKKRRELGVSRKKIQERIQDKEKDMKVLQEEVEAITQSADKAVRDSEKIF
NDVKQRIRSRQKAEVCRARELQDRIENEITVLKRKDAELGQLFHTQDHTHFLQTYTSLSQ
VHESVGSLDIKTCTLHYFEDVMTAVSEFKRKLQEIRFGAAGSQLEGEVDAVTSRPEPKTR
AEFLRLSQELTLDLNTANTSLLFEGDKKVKCMSKKFVYRHHSDRFINRHQVLSRESLTGC
CYWEVVWSGGALSVAVSYKNISRTGDESLFGNNDSSWALECFKNGYELRHNKIRTVISGP
QSPRIGIYVDHRAGILSFYSVSKTMSLLHRVQTTFTQPLYAGF
Download sequence
Identical sequences I3KZ11
ENSONIP00000026358 ENSONIP00000026358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]