SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026440 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026440
Domain Number 1 Region: 380-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-50
Family SPRY domain 0.00032
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 8.95e-21
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 3 Region: 143-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000214
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026440   Gene: ENSONIG00000021138   Transcript: ENSONIT00000026464
Sequence length 558
Comment pep:novel scaffold:Orenil1.0:GL831137.1:3142625:3144298:-1 gene:ENSONIG00000021138 transcript:ENSONIT00000026464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVQLHPESFSCSICLDILKDPVTVPCGHSYCMDCIKTHWDEEQGKRICSCPQCRQA
FTPRPVLVKSTMLAELVEELKKTALQAASVYQRCAGPEDVACDLCTGRKLKAVKSCLVCL
VSYCEQHLQPHYDVALLKKHKLADPFKRLQENICSRHSEVMKIFCRTDQQSICYVCSLDE
HKGHETVSAVAERSERQRALEVSRLQIQQRIQNREKEVNVLQLEVRAMSFSADKAVEDSE
KIFTELIRLIWKRSSDVKRQIRSQQETEVSRVKELQEKLEQEIAELKNKDAELKQLIDTE
DHNLFLHNHPLLSPLRQPIDSSSINIRPLRYFEDVTAAVSETRNKLQDILSETWANISLI
VTQVDVLLSVPKPEPRTRAGFLNYSRAITLDPNTANKWLLLSEGNRKATLMKQQQSYSNN
PHRFTAWSQVLSRESLTGRCYWEVEWIGIGFHIAVAYKNIGRAGWGDECKFGRNEKSWAL
NCHKKAYEFWHNNSHTSISGPHFSKIGVYLDHSAGILSFYSVSETMTLLHRVHTTFTQPL
YAGFWLFSDVKTTKFCKL
Download sequence
Identical sequences I3KZ93
ENSONIP00000026440 ENSONIP00000026440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]