SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026466 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026466
Domain Number 1 Region: 358-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-62
Family SPRY domain 0.00000579
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-19
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-18
Family B-box zinc-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026466   Gene: ENSONIG00000021164   Transcript: ENSONIT00000026490
Sequence length 541
Comment pep:novel scaffold:Orenil1.0:GL831405.1:130338:131960:1 gene:ENSONIG00000021164 transcript:ENSONIT00000026490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLLSRDQFQCSICLDILTDPVSTPCGHNFCKNCISQHWDISETCQCPTCKKVFET
RPELHVNTFISEMVSQFRREVQQKTSTSISEQQAAKPGEVPCDICTGTKLKALKSCLVCL
ASYCQTHLEPHLTASRLKRHQLIDPEENLEGWMCMKHDQPLELFCKTDQTCVCMLCSVID
HKTHEFVPLREEYEEKKAELGKTETEIQQMITKRQLKVQEIKQSVKMSKDAADREKAEGV
QVFTALTKSLRKSLNELIKEIEDKQETTEKQAEGFIKDLEQEISELMKRSSEVEQLSRSK
DHLHLLQRFSSLKAAPTTKDWTEVSIHPPSYEGTVVRAVDQLKETLSKDMKKLFEAELKR
VQQYAVDVTLDPDTAHPKLILSDDERQVHHDDEKKNLPENPERFSKGVCVLGKQSLSSGR
FYFEVRVKEKRDWILGMVRESVKRKEEITLSPEDGYWTVAVVNGNVCVAFEDSQVRLTPQ
FCPEKVGVFVDYEEGLVSFHDVDDAALIYSFTGCSFTRKLYPFFCPGVNDNGKNSAPLIV
C
Download sequence
Identical sequences I3KZB9
ENSONIP00000026466 ENSONIP00000026466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]