SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026515 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026515
Domain Number 1 Region: 378-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-51
Family SPRY domain 0.00085
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026515   Gene: ENSONIG00000021213   Transcript: ENSONIT00000026539
Sequence length 558
Comment pep:novel scaffold:Orenil1.0:GL831411.1:105853:107526:1 gene:ENSONIG00000021213 transcript:ENSONIT00000026539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELEFQNDETKLCCSICLDILKDPTTIPCGHNYCMNCIKAHWDAEDTKQAHSCPQCRQT
FTPRPFLMKNTMLAELVEELKRIRLQDAPDDDHCYAGPEDVACDVCTGRKMKAFKSCLCC
LASYCEKHLQPHYDVVPLKKHKLVEPSKKLQENICSRHDEVMKMFCCTDQQSICYLCSVD
EHKGHDTVSAAAERTERQRELEVSRQNIQQRIQDREKDVKLLQQEVEAINQSADQTVEHS
EKIFTELIHLIQNRSSDVKQQIRSQQETEVSRVKELEEKLEQEITELKRKDAELKQLSHT
EDHIQFLHNYPSLSALSESTDSSSINIRPLRYFEDVTAAVSEVRDKLQDILREEWTNISL
TVTEVDVSLSDPPEPKTRAEFLKYSCEITLDPNTAHKQLLLSEGNRKATAVKQQQSYSDH
SDRFAIMWQVLSRESLTGRCYWEVEWRVNGAYVAVAYKNISRAGSGNECRFGRNEKSWAL
DCFKNSYTFWYNNIQTRVSGPRSSRVGVYLDHRAGILSFYSVSETMTLLHRVQTTFTQPL
CAGLWLHCFGNTAKFCKL
Download sequence
Identical sequences I3KZG8
ENSONIP00000026515 ENSONIP00000026515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]