SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026572 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026572
Domain Number 1 Region: 358-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-68
Family SPRY domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 8.05e-21
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 3 Region: 143-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.9e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026572   Gene: ENSONIG00000021270   Transcript: ENSONIT00000026596
Sequence length 547
Comment pep:novel scaffold:Orenil1.0:GL831145.1:7665336:7666976:-1 gene:ENSONIG00000021270 transcript:ENSONIT00000026596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASNLQSEDQFLCSICLDVFTDPVSTPCGHNFCKNCITQHWNTNGRHNCPMCNRVFKR
RPELDINTLFSEMVAQFRHEAQQKASSSSSEQQAAKPGEVLCDVCTGTRLKALKSCLVCQ
TSYCQTHLEPHLTKKALRGHQLIDAVENLEDKMCKKHEKPLELFCKTDQTCVCMLCSVLE
HKNHEFVPLREEYEGKKAELGKTEAVIQQMIQKRRLKIQELKESVKTSKGAADRQKAEGV
QVLTALKESVERRLKELKKEIEDKQETTEKQAEGLIKDLEQEISELMKRSSEVEQLLHSE
DHLHLLQSFSSLKAAPPTKDWTEVRVRPPSYEGTVVRAVAQLEETLRKDLKKLFEAELKT
VQQYAVDVTLDPDTAYPNLILSDDGKQVYCGDVRINVPDNPERFSACVCVLGVQSFSSGR
FYFEVQVKGKTDWDLGVARESINRKGNVMLRPQYGLWTVVLRNGNEYRACAGPSFRLCLY
SGPEKVGVFVDYEEGLVSFYDVGTGALIYSFTGCSFTHKLHPYFSPYMNQGGNNSSPLII
CPVNHTE
Download sequence
Identical sequences I3KZM5
ENSONIP00000026572 ENSONIP00000026572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]