SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026615 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026615
Domain Number 1 Region: 358-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-61
Family SPRY domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-17
Family RING finger domain, C3HC4 0.0086
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.36e-17
Family B-box zinc-binding domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026615   Gene: ENSONIG00000021313   Transcript: ENSONIT00000026639
Sequence length 546
Comment pep:novel scaffold:Orenil1.0:GL831292.1:935732:937369:-1 gene:ENSONIG00000021313 transcript:ENSONIT00000026639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLLSEAQFLCSICLDVFTDPVTTPCGHNFCKNCISQHWDIRERCHCPICIKLFKR
RPRLYINTFISEMVAQFKCELQQKVSSSSSEQQAAKPGEVPCDICTGTKLKALKSCLVCL
ASYCQTHLEPHLTMKGLKRHQLIDPEENLEGRMCMKHDKPLELFCKTDQTCVCMLCSVLD
HKTHEFVPMREEYEGKKAELGKTEAEIQQMITKRRLKIQEIKKSVKMSKDAADRQKAEGV
QVFTALKESVDRRLNELIEEIEGKQETTEKQAEGFIKDLEQEISELMKRSSEVEQLSRSK
DHLHLLQSFSSLKPAPTTKDWTEVSIHPPSYEGTVVRAVDQLKETLDEEFEEVFEAELKR
VQQYAVDVTLDPDTAHPHLILSNAGKQVHYGEKKRNIPDNPERFSNSGCVLGKQSLSSGR
FYFEVQVKDKTNWILGMARQSVNRKEVITLSPEKGYWTVVVHKNICLALDDPQVPLFLQS
DLEKVGVFVDYEEGLVSFYDVDNAAPIYSFTGFYFTEKLYPLLYSGVNVDGENSAPLIIC
PVNQSV
Download sequence
Identical sequences I3KZR8
ENSONIP00000026615 ENSONIP00000026615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]