SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026616 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026616
Domain Number 1 Region: 358-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-64
Family SPRY domain 0.00000597
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-19
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.33e-16
Family B-box zinc-binding domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026616
Domain Number - Region: 198-297
Classification Level Classification E-value
Superfamily t-snare proteins 0.0275
Family t-snare proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026616   Gene: ENSONIG00000021314   Transcript: ENSONIT00000026640
Sequence length 537
Comment pep:novel scaffold:Orenil1.0:GL831292.1:1137082:1138692:-1 gene:ENSONIG00000021314 transcript:ENSONIT00000026640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLLSEDQFLCSICLDDFTDPVSIPCGHNFCKNCISHHWDISERCQCPMCKKVFRM
RPELHVNSFISEMVSQFRREAQQKVSSSSSEQQAAKPGEVPCDICTGTKLKALKSCLVCL
ASYCQTHLEPHLTVSCLKRHQLIDPEENLESRMCMKHNKPLELFCKTDQTCVCMLCSLID
HRTHEFVPLREEYEGPKSELIKTAAEIQQMVQKTRLKIQEIKESVKMSKDAANREKAEGV
QVFTALKESVDRRLNELIKEIEDKQESTEKQAEGFIKDLKQEISELMKRSSEVEQISHSK
DHLHLLQRFSSLKAAPTTKDWTEVSIHPPSYEGTVVRAVDQLKETLSKDMKKLFEAELKR
VQQYAVDVTLDPDTAHPYLILSDDGKQVHCGEEEKDLPDNPERFSEFPIVLGKQSFSSGR
FYFEVQVNDKTEWALGVARESVNRKEVMTLSPKNGYWTVGVCENICVAVDDLPVHLPLQS
GPQKVGVFVDYEEGLVSFHDVDDVDVIYSFSGFSFTEKLYPFFCPGGNDGGKNSDPL
Download sequence
Identical sequences I3KZR9
ENSONIP00000026616 ENSONIP00000026616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]