SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026626 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026626
Domain Number 1 Region: 381-546
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-48
Family SPRY domain 0.00042
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 142-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026626
Domain Number - Region: 186-319
Classification Level Classification E-value
Superfamily t-snare proteins 0.0337
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026626   Gene: ENSONIG00000021324   Transcript: ENSONIT00000026650
Sequence length 560
Comment pep:novel scaffold:Orenil1.0:GL831197.1:2423929:2425608:-1 gene:ENSONIG00000021324 transcript:ENSONIT00000026650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHKNLMDKEKFCCSICLDLLTDPATIPCGHSYCMNCIKTQWDSEDTKQIHSCPQCRQT
FTPRPALVKSTMLADLVDELKKIGLQAAPSDHSYAEPEDVACDFCTGVKLKAIKSCLVCL
ASYCEKHLQPHYDSLTFKKHKLVEPSKKLQDNICSRHDEVMKIYCRTDHQSICYLCSMDE
HKGHNTISAAAERTERQKELEVSQENIQQRIQDKEKDVKLLQHEVEAISRSADKAVEESE
KIFTELICLIQKSCSDVKQQIRSQQETEVSRVKELQEKLEMEITELKRKDTELKELLNTE
DHNQFLQNYLSLSALTESTESSSINMRPLGYFEVVTTAVAEVRDKLQHILREKCTDISLI
VTEVDVLLSDPQAEPKTRAGFLKLSREMTLDPNTANTWLLLSERNRKTTAMNNQQPYSDH
PDRFTDYWQVLSTDRLTGRCYWEVEWRGGVHVAVAYKNINRVGMGNECGFGGNARSWALK
CSQNSYTFWHNNIQTLISGPQSSRIGVYLDHSAGILSFYSISETMTLLHRVQTTFTQPLH
AGLRLNGWFVFGASAKFCKL
Download sequence
Identical sequences I3KZS9
ENSONIP00000026626 ENSONIP00000026626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]