SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026758 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026758
Domain Number 1 Region: 378-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-51
Family SPRY domain 0.00043
Further Details:      
 
Domain Number 2 Region: 8-82
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 145-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000014
Family B-box zinc-binding domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000026758
Domain Number - Region: 209-281
Classification Level Classification E-value
Superfamily BAG domain 0.0942
Family BAG domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026758   Gene: ENSONIG00000021456   Transcript: ENSONIT00000026782
Sequence length 556
Comment pep:novel scaffold:Orenil1.0:GL831421.1:475867:477534:-1 gene:ENSONIG00000021456 transcript:ENSONIT00000026782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGVQLDQEAFSCSICLDLLKDPVTTACGHSYCMNCIKFHFDEEDRKGIHSCPECRKT
FIPRPVLEKNIMLANLVEQLKKTGLQAAPADHCYAGPEDVACDVCTGRKLKAIKSCLFCL
ASYCEKHLQPHYDVAPLKKHKLGAPSKKLQENICSRHDEVMKIFCRTDQQSICYLCTMDE
HKGHETVPAAAERTEKQKQLELRRLNIQQRIQEREKDVKLLQQEVEAINGSADKAVEDSE
KMFTELICLIQKRSSDVKQQVRSQQETEVSRVKELQEKLEQEIAELKRKDGELEQLSHTE
DHNQFLHNYPSLSALSESTHSSSINIRPLRYFEDVTAAVSETRDILQDILREEWTNISLT
VTAVDVLLSPPEPKTRAGFLKCSCEITLDPNTANTHLLLSEGNRKAKFMKQQQSYSDHPD
RFTGWRQVLSRESLTGRCYCEVEWRGGTVCVAVTYKNISRAGRGNECGFGYNDKSWALYC
YTNSYKFLHNNVNTDLSGPRSSRVGVYLDHRAGILSFYSVSETMTLLHRVQTTFTQPLYA
GLYIWGNGATAELIKV
Download sequence
Identical sequences I3L061
ENSONIP00000026758 ENSONIP00000026758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]