SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|452202489|ref|YP_007482774.1| from Bacillus thuringiensis serovar thuringiensis str. IS5056

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452202489|ref|YP_007482774.1|
Domain Number 1 Region: 20-415
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.38e-96
Family Amylase, catalytic domain 0.0000000000974
Further Details:      
 
Domain Number 2 Region: 419-504
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.6e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.00029
Further Details:      
 
Domain Number 3 Region: 592-693
Classification Level Classification E-value
Superfamily Starch-binding domain-like 4.17e-16
Family Starch-binding domain 0.0000641
Further Details:      
 
Domain Number 4 Region: 509-584
Classification Level Classification E-value
Superfamily E set domains 0.00000000000591
Family E-set domains of sugar-utilizing enzymes 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|452202489|ref|YP_007482774.1|
Sequence length 703
Comment Cyclomaltodextrin glucanotransferase; Maltogenic alpha-amylase [Bacillus thuringiensis serovar thuringiensis str. IS5056]
Sequence
MLLWDGGCHLKEKDKLKVNRNNVNFSKDVIYQIVTDRFHNGCPSYNPKGGLYDESRKNKK
KYFGGDWIGIIEKLNTNYFTELGVTSLWISQPVENIFTPINDLVGSTSYHGYWARDFKRT
NPFFGTFEDFQTLITTAHAKDIKIIMDFAPNHTSPALHDDATYAENGRLYDNGLLLGGYD
NDYNHYFHHNGGTDFEEYEDGVYRNLFDLADLNHQNIAIDLYFKEAIKLWLDQGIDGIRV
DAVKHMSYGWQKSWLNSIYNYRPVFIFGEWYINPNEYDHRNVHFANNSGMSLLDFSFAHK
VREVFRDGMDSMHGLHKMVEETYQIYNDVNNLVTFIDNHDMDRFHINGQSKRRIEQSLAF
LLTSRGIPSVYYGTEQYMVGNGDPNNRGQMESFDVNTDNFKIIQSLSSLRSLNYALPYGN
TKERYITDDIYVYERYFGSDVVLIALNRNLTEGYEIKDVKTILPSRKYKDILDGLLDGEA
IRVENNNIDSLWLGPGSVHVWHHKGVNSIPLIGTVGHKMTTVGQIICIEGCGFTSKKGSV
LFEEKEAEVVSWSHTSIKVKVPAVNDGKYEITVVTDTGTRSNIYKHVEVFNTKQVCIRFV
IENGYEIPESEVFIMGNTYSLGNMNPCKAVGPFFNQIMYQFPTGYLDISVPVDTLLEFKF
IRKINKTLLIEGGENHKYRTPSFGTGEVVVKWQTAEKTILVES
Download sequence
Identical sequences M1QLI4
gi|452202489|ref|YP_007482774.1|NC_020385 gi|452202489|ref|YP_007482774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]