SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410658501|ref|YP_006910872.1| from Dehalobacter sp. DCA

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410658501|ref|YP_006910872.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.44e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000302
Further Details:      
 
Domain Number 2 Region: 3-50,172-226
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 7.85e-32
Family RNA polymerase alpha subunit dimerisation domain 0.00054
Further Details:      
 
Domain Number 3 Region: 247-311
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 3.27e-23
Family C-terminal domain of RNA polymerase alpha subunit 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410658501|ref|YP_006910872.1|
Sequence length 315
Comment DNA-directed RNA polymerase alpha subunit [Dehalobacter sp. DCA]
Sequence
MLEIEKPNIECVERSEDNTYAKFIIEPLERGYGITLGNSLRRILLSSLPGSAVTSVKIEG
VLHEFSTIPGVLEDVTEIILNIKSLALKGHTDEPRVLRLECEGERVVTARDIITGPDIEI
LNPDLKIATLDKDGRLFMEMNVERSRGYVSAEKNKKADQVIGVIPVDSIFTPIYKVNYAV
EDTRVGMMTDFDKLTLEVWSNGSITPKEATSLAAKILSEHLRLFIGLNDNLGNVEIMVEK
EEEAKDKILEMTIEELDLSVRSYNCLKRAGINSVEELTQRTEEDMIKVRNLGRKSLEEVE
HKLRELGLGFRTPED
Download sequence
Identical sequences K4L621 T0I9R0
gi|410661488|ref|YP_006913859.1| gi|410658501|ref|YP_006910872.1| WP_015043916.1.6016 WP_015043916.1.71633 WP_015043916.1.88763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]