SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT08212 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08212
Domain Number 1 Region: 88-195
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.92e-23
Family Glutathione S-transferase (GST), C-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 8-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.75e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT08212
Sequence length 241
Comment pep:novel supercontig:GCA_000347335.1:Scaffold70240:1848:2697:-1 gene:F775_27020 transcript:EMT08212 description:"Uncharacterized protein "
Sequence
MAGDAELKLLGWWAPGVSPYVLRAQMALAVKGLSYEYLPEDRWSKSDLLVASNPVYKKVP
VLIHDGRPVCESLHIVEYLDDAPGLAGNGTSILPADPYSHAVARFWAAYVNDKEERGGKV
EETLSGLRHLEAALAECSKGEVEAPFFGGGSIGFLDIALGCYLPWFEAVGRLAGLGPIID
PARTPKLAAWAERFSVAKPIQQQAWGRQAGGVHHYGALSKVEHRGHRQLIKDLVVPLWQK
K
Download sequence
Identical sequences M8AUS4
EMT08212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]