SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT13327 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13327
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Lysozyme-like 2.14e-33
Family Family 19 glycosidase 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT13327
Sequence length 85
Comment pep:novel supercontig:GCA_000347335.1:Scaffold48187:38904:39161:1 gene:F775_30750 transcript:EMT13327 description:"Basic endochitinase C "
Sequence
MTPQSPKPSSHDVITGRWSPSGADQAAGRVPGYGVITNIINGGLECGRGQDGRVADRIGF
YKRYCDLLGVSYGDNLDCYNQRPFA
Download sequence
Identical sequences N1QUV3
EMT13327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]