SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT13406 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT13406
Domain Number 1 Region: 78-192
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-22
Family Thioltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT13406
Sequence length 272
Comment pep:novel supercontig:GCA_000347335.1:Scaffold47952:32310:33563:-1 gene:F775_26336 transcript:EMT13406 description:"Thioredoxin-like protein 1 "
Sequence
MASALCGGGGSVAAPCGDLGAAAALAESLPMGAGYRSKSSFPAGRVALADRPLPRSLQAA
AAAGQMNGNLTIGKAMRWWEKVTHPNMREVESAQDLAYSLLNAGDKLVVVDFFSPGCGGC
RALHPKIAQFAERNPDVLFLQVNYEKHKSMCYSLHVHVLPFFRFYRGAQGRVSSFSCTNA
TIKKFKDALAKHSPDRCSLGPARGLEEAELLALAANRDLEFTYNEKPTLVPIAEAIQMEA
ASIGGPWMPLPAAATQPLTLGSENGSLIPSGR
Download sequence
Identical sequences N1QUW2 W5C592
XP_020174266.1.58150 XP_020174895.1.58150 Traes_2DS_5A8D0F48E.1 EMT13406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]