SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT14919 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT14919
Domain Number 1 Region: 66-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000716
Family Selenoprotein W-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT14919
Sequence length 161
Comment pep:novel supercontig:GCA_000347335.1:Scaffold43212:42242:45855:-1 gene:F775_29336 transcript:EMT14919 description:"Uncharacterized protein "
Sequence
MVRSPSVAAAFAVLLLCLSGLSRGAERLGARECEELGFTGLALCSDCNALAEFVKDQELV
DDCRKCCTEDSDDSISKLVYSGAIIEVCMRKLVFYPEVVGFLEEDKDAFPYVESRIDNWK
REHIRQFLTEKREYMLFEDTCEYLFFDKGRCFGASATTWDI
Download sequence
Identical sequences N1QXK8
EMT14919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]