SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT04779 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT04779
Domain Number 1 Region: 481-556
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000471
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 565-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 3 Region: 157-211
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 4 Region: 316-363
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000073
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  EMT04779
Domain Number - Region: 741-781
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00012
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT04779
Sequence length 787
Comment pep:novel supercontig:GCA_000347335.1:Scaffold93250:35291:43392:1 gene:F775_52141 transcript:EMT04779 description:"Uncharacterized protein "
Sequence
MTLFSDESTILEEVSIDCDNKVAIYDDYCDDKIFGVTEIWALFSSLKFCVIEVFKFWVRY
RHEENKEWQDPKLGDAQGTPRTTPSLVAPMGSTFFFENFPWEVLSLKNWRGPAVYDMASH
AYPSKRPFQKKYSEHNGRAKWQKTKHAPSQQTQLTIQPGVPLIRILCPTEKCGNVIGKGG
SIIAKIRQENGVKIRVDEAVPGCDERVIVITTVEKDKEASHEQGKENDGGTAVSADGEHE
KEKDHSKEEKDDSDNAHGKEEQDDAERDDSKEENDDSSVAKTTKLEPERVIPSAMNAVLH
VFDRIFITESENGTGDASGQKTPLSFRLLVLDSQVGSLLGIRGSVIKQMSADSGCEIRVS
KENLPLCALLKDELCQCIQDFAFGRLYFWHFLIYHFCRLMESLTQLGKINGELDSVRKDG
LPPGMPPNFHLPFQGPSHARGPFDTIDQRPNVAPFPTFPDQRSNIPPFSAFPDALMHGNA
SVPPEPLTFRLLCSSDKVGSIIGKGGNSIKTIQKDTGCEIKILETIPKSDDHIIIISGPA
HPGDGISPAQNAILHVQRKITPPTSNKEGPAISRLIVSPNQVGCLLGKGGSIIAEMRKLS
KAHIIVLSKDKIPRGVQEIDEVVQITGDSEAIQEALMQITARLRNNLFRDRMASMGPSMQ
PPFGLLDPQFGAFAGIHESTSPRIYPNASQFHKDFMGRPLDEMPAPWTTKDVGDPMSISG
IPGMAHRDWNGTQRNGWILWFSGAKITIDEPLADSIDTPVMISGTPDQMHAARSLVQAFV
LSEPPAS
Download sequence
Identical sequences M8ATP7
EMT04779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]