SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT06016 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06016
Domain Number 1 Region: 162-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000577
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 2 Region: 268-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000589
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 95-125
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000392
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 36-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000157
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT06016
Sequence length 304
Comment pep:novel supercontig:GCA_000347335.1:Scaffold83693:3649:6111:1 gene:F775_30479 transcript:EMT06016 description:"Zinc finger CCCH domain-containing protein 31 "
Sequence
MDAAARKRSRPESANGGAAGGKRSRESESQQTGLSSKSKPCTKFFSTVGCPFGEGCHFAH
FVPGGYQAVSKSHSLGHAAVSAPSRAPADHAASGVKTRMCTKYNTAEGCKFGDKCHFAHG
ERELGRAPSSYMSQESSYAPPMGGRYGGRHEPPPPASMGPPAGNFGASSTCKVSVDAALA
GGIIGKGGVNTKQICRITGVKLSIRDHESNPDLKNIELEGSFDQIKQANDMVRDLIASIS
ASTPSKNPAGAAAPAVRGGGGGGPGGRSNYKTKICENFLKGTCTFGERCHFAHGETEQRK
GAAV
Download sequence
Identical sequences A0A1D6DBA2 M8ANA6
XP_020173136.1.58150 EMT06016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]