SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT06507 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT06507
Domain Number 1 Region: 479-763
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-72
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 373-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000294
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT06507
Sequence length 933
Comment pep:novel supercontig:GCA_000347335.1:Scaffold80274:26498:31481:-1 gene:F775_25510 transcript:EMT06507 description:"Wall-associated receptor kinase 5 "
Sequence
MGPATPHTIHLILEIVPSLPDTPSASDEHQCTAVVQGGALRHSNLYFCTKVVSRRKKVAY
KGNLGPLMDNFHSIPENMQVLLQLGLSLVLLAPQYTTTAAAPSSQCQRQCGNVDIPYPFG
IGVNCSLSKRFTINCTVQDGIHKPFRGDFEVLDISLTHATIRMLNYILGFCYNTSTRSME
SVGRYGRRIQIRSGPSSPLRLSDARNKFTVIGCNALAFISDNDTGYQGLGVATCRDPLEL
VDGSCSGMGCSQTTIPNKIYNYEVGFSTFANTSRIWRFNRCSYAVLMEAAEFKFDVSYIN
TTKFNDTNAGRAPVVYDWAIRDVVRCDVARRNKTGTYACLSSNSKCVDSTNDQGYMCNCT
HGYEGNPYLQDGCTDVNECNYNPCPSDGFCHNIIGEHWCSCRVGKRYVKQSNTCNPDTGF
IIGVTMGLFGLMVFIVITIFWGQLIIQKRKLNKVKQEYFRQHGGLLLFDRMKSDKGLAFT
VYSLAELIHATDNFDNSRILGKGGHGTVYKGIIKNMPIAVKRCALVDDRQKKEFGQEMLI
LSQINHKNIVKLLGCCLEVEVPILVYEFVPHGTLFELIHGKNHALQISFNTLLRIAHEAA
EGLCFLHSYASPPIIHGDVKTSNILLDDNYMAKVSDFGASILAPSDKEQFVTMVQGTCGY
LDPEYMQTCQLTEKSDVYSFGVILLEILTGQLPLKLKGSETQRSLSSIFLSAMKENNLDA
VLVSHVKGEESMELLRGLADLAKKCLDMCGDNRPFMKEVADELNRLRKLSMHPWVRIDLE
MDAESLLGGESTSGYEIELNGYPMGESENQPINPRSSYYARLALLLFDPAPRSRFIPPLF
QAKIRRGKCLMEVSPDQHRAPDDVHDRTTDEQVLHIFLSRFAEATKLAMREASFNEPVIR
PDSTSCGQPYEKFASKRGPRFPNTVGAAAKNAP
Download sequence
Identical sequences M8BU88
EMT06507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]