SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT08733 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT08733
Domain Number 1 Region: 365-564
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-58
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000288
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Domain Number 3 Region: 52-145
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000144
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT08733
Sequence length 564
Comment pep:novel supercontig:GCA_000347335.1:Scaffold67702:44366:46060:-1 gene:F775_12915 transcript:EMT08733 description:"Putative receptor protein kinase ZmPK1 "
Sequence
MRDDGNFVLFGADGTVVWQTFESPTDTLVAGQDLVPAAQLFSGVSDTNKAVGKYQLTNQQ
QDSNLVLYPVGTPNDAASSYWNTGTFDLGFTLILRLDTSGLLYQVNNDGSFTKNLTQPGA
LKAGEQANYRLTLDPDGVLRLYRHAFVSGGASNTTVAWSALTGRCLVHGVCGYKSYCVLD
QDRPSCLCPHGFDFVNASNSALGCTVNSGDCKGGQQQDTVDFSVKFMSNMEWADIPYEVV
GKATSAADCMTACMADCLCVAVLQDADKGTCSKQQLPLRYGRRGGRYTLFVKTAGAATNG
SKPIGRTTIIMLVCIGILAFVALSAFTASGWLLHVKRRAVLRNVAPANAEAGGGEGLEEE
EVAPLRSYSYQEMERATYCFRDPVGRGAFGTVFKGALRNCEKAIAVKRLEKLVEDGEREF
QREVRAIRRTSHRNLVRLLGFCHEGAHRLLVYEFMSNGSVADLLFRGASTPSWSDCLGIA
LDVARGLHYLHDELSSRVTHCDVKPQNILIDAAGTAKIADFRLAKLLQPNQTRTFTGVRG
TRGYLAPEWYRGTGPVTAKVDVYS
Download sequence
Identical sequences M8C0M2
EMT08733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]