SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT09315 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT09315
Domain Number 1 Region: 47-144,176-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.24e-25
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  EMT09315
Domain Number - Region: 339-383
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000373
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT09315
Sequence length 432
Comment pep:novel supercontig:GCA_000347335.1:Scaffold64759:73704:75432:-1 gene:F775_11789 transcript:EMT09315 description:"S-locus-specific glycoprotein S13 "
Sequence
MLFPFCASSGSRLLPDKPLSARSTITSDDGTFALGFFSPSSSGTKHYYVGIWYKNIPQDN
IVWVANRAMPIADPSSAILAFTNKFNLALSDTNGQLLWMTNISATGNSSSEATGGEAMLD
NNGNFILQSSEGIILWQSFDYPTDTLLPGMNLRITHRTHALQRLISWRNPQDPSPGNFSY
GADPDEFLQRFIWNGSTPYRRSPVWNNFLVVGQYIESIRSTIYFTLQTIDDEVYISFGLP
APSVSSLLLVKMDYSGKMKIRTWKSNVSKWTDLQSEPNQECNKFGYCGPFGYCDNTQPIV
TCKCFDGFEPNNKQEWTAHRFSQGCHRMEALRCGQGDGFLNTSNMKVPDQFVFVKNRSLD
ECIAECTSNCSCTAYAYANMSTKFMNGDETRCLLWIGDLIDTEKLIGQGENLYIRINGLN
GKVYCLCFLCLC
Download sequence
Identical sequences M8B6T4
EMT09315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]