SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT10788 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT10788
Domain Number 1 Region: 171-270
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000708
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 269-299
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000406
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 97-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000222
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 33-58
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000107
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT10788
Sequence length 304
Comment pep:novel supercontig:GCA_000347335.1:Scaffold58073:68783:71406:-1 gene:F775_13893 transcript:EMT10788 description:"Zinc finger CCCH domain-containing protein 14 "
Sequence
MEGGGRKRGTADGAAVGGKRTRESESFQTGVGSKSKPCTKFFSTSGCPFGEGCHFLHYFP
GGHQAVAKMSNLGGQAFAHPQGRMPTGSAVPDGHPTPTVKTKLCNKYNTAEGCKWGDKCH
FAHGERELGKQTFINNSMPPHMGPRPTGHFGPPAMPSPGMATPAGFGASSTAKVSVDASL
AGAIIGRGGVNTKQISRVTGAKLAIRDHESNEALKNIELEGTFDQINNASAMLRELIFRI
SGGANAPPPGVILAGGSHRGGGGGGQGSNFKTKLCDNFTKGSCTFGDRCHFAHGENELRK
SAAA
Download sequence
Identical sequences M8C6Q2
XP_020164455.1.58150 EMT10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]