SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT11963 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT11963
Domain Number 1 Region: 80-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.45e-23
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  EMT11963
Domain Number - Region: 203-264
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0109
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT11963
Sequence length 436
Comment pep:novel supercontig:GCA_000347335.1:Scaffold52929:67369:68679:1 gene:F775_03328 transcript:EMT11963 description:"Putative receptor protein kinase ZmPK1 "
Sequence
MRPLRGGPGAGADLAVLCCCFLLLSFLSHGADMPLGSSLSPAANSTSWSSPNSTFSLAFV
PSPTSRSLFVAAVTYAGGVPVWSAGAGAAVDSRGSLRLSSSGDLQLVKGSGAVLWSSGTA
GQGVAAAALQESGNLVLTNSRGRVLWQSFDHPTDTVVMSQSFTSGMNLTSGPYVFAVDRS
GNLTLNWASAGAAPVTYFNKGYNNSFTAKKTVTLTMQTNGIVSLNDGSLVNPVVVAYSSN
YAESGDMLRFLRLDSDGNFRAYSAARGSGTATEQWSAVADQCQVFGYCGNMGVCSYNRTS
PVCGCPSRNFELIDASNPRSGCKRKTELQNCPGTSTLLQLDNTQFLTYPPEIAIEQFYVG
ITACRLNCLAARSCVGATALSDGSGLCWLKVSNFVSAYQSASLPSTSFVKVCFPGVPNPP
VSTTNAWSPGTSGLHG
Download sequence
Identical sequences M8CA09
EMT11963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]