SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT14828 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT14828
Domain Number 1 Region: 47-79
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000262
Family alpha-D-mannose-specific plant lectins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT14828
Sequence length 228
Comment pep:novel supercontig:GCA_000347335.1:Scaffold43488:13520:14295:1 gene:F775_01198 transcript:EMT14828 description:"S-locus-specific glycoprotein S6 "
Sequence
MFDSGGDVTDGETLVSAGGAFTMGFFSLGVPARRYLGIWFSVSEDAVCWVANRDSPLTGT
SGVLVLGNAGRLLLMDRGQRRPPVAVVRPSVEHLAARHEDRQEPVDGGRVVHHVVALSHR
PVSRPLPKALPENALWHDGVNKYRTGPWNGVHFNGVAEMASYADMFSYQVTVSPGEVTYA
YHAKAGAPFSRVVVTDAGAIQRLVWDTSSRAWKTFYFFKRRMTSGLCI
Download sequence
Identical sequences N1QWX3
EMT14828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]