SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT14830 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT14830
Domain Number 1 Region: 78-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-26
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT14830
Sequence length 416
Comment pep:novel supercontig:GCA_000347335.1:Scaffold43488:47300:48550:-1 gene:F775_23153 transcript:EMT14830 description:"S-locus-specific glycoprotein S13 "
Sequence
MEVTRDHLGLTLPLFLFLLLSPGALVTGVSDLLNEGNNITDGNTLVSADGSFILGFFSPG
VSTNRYLVIWFSVSNTTVCWVANRERPVNSTAGVLVFSDTGNLLLLDGSGQTVWTSNSTT
RAAPGVAQLLESGNLVIREQAGHTTVWQSFDYLSDTLLPGMKMGKNRWTGSEWYLSSWRS
ADDPSPAYRFVTEANGLPDNTLWDGSTKVYRTGPWNGLRFSGTTEDATYTDMFKFVVTIN
DGEVTFGYTATPGTPPSRIVATSTGFVKRLVWEESRKRWETFLQGPRDVCDAYAMCGPFG
LCNANAPSTSFCSCPRGFTPAFPAEWDLRENSGGCRRSAALDCAQGNEGARTSSNAPSTS
FCSCPRGFTPAFPAEWDLRENSGGCRRSAALDCAQGNEGASASRTAGFMVLQGVKR
Download sequence
Identical sequences N1QXH4
EMT14830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]