SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT15304 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15304
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily At5g01610-like 8.5e-31
Family At5g01610-like 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT15304
Sequence length 143
Comment pep:novel supercontig:GCA_000347335.1:Scaffold41945:23806:24861:1 gene:F775_19130 transcript:EMT15304 description:"Uncharacterized protein "
Sequence
MDEIMNKMGSYWLGQRANKEMSSAGDDIESLSTSVGDGAKWLVNKLKGKMQKPLAELLQE
HDLPAGVGYRDGSELRFDTTVAGTLDKGSLTGVEGLKAKVLVWARVTAVKADAAKVYFAV
GIKKSRSREAYEVIRGAITVDEF
Download sequence
Identical sequences N1QXF0
EMT15304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]