SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT15490 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT15490
Domain Number 1 Region: 29-128
Classification Level Classification E-value
Superfamily SIS domain 5.56e-16
Family mono-SIS domain 0.021
Further Details:      
 
Domain Number 2 Region: 29-75,144-271
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000000545
Family mono-SIS domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT15490
Sequence length 313
Comment pep:novel supercontig:GCA_000347335.1:Scaffold41255:7773:12107:1 gene:F775_00330 transcript:EMT15490 description:"Uncharacterized protein "
Sequence
MASRPRSLDTPAILNHRATIPAPCYRHPSMSGASDELLALAPCARAKGAQLISLTSAASG
SDCPLAAACDLNVHLPLQGEVCPFGLAPVTSTAIQMVFGDTVVAAIMEARRLTRDQYASN
HPAGKIGKTLIFKGEVCPFGLAPVTSTAIQMVFGDTVVAAIMEARRLTRDQYASNHPAGK
IGKTLIFKVKDVMKKQNELPLCKEGDMIMDQLTELTSKGCGCLLVVDDEYHLIGTFTDGD
LRRTLKASGPAIFSLTVGEMCNSRGRIWKTFWNNSLENGKMGNNIHGWYHSKKISSIFGI
KNLLKQDEVKHKC
Download sequence
Identical sequences N1R0I6
EMT15490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]