SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT20027 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20027
Domain Number 1 Region: 201-353
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.53e-30
Family Thioltransferase 0.00089
Further Details:      
 
Domain Number 2 Region: 85-188
Classification Level Classification E-value
Superfamily TPR-like 2.61e-24
Family Tetratricopeptide repeat (TPR) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT20027
Sequence length 357
Comment pep:novel supercontig:GCA_000347335.1:Scaffold28944:9189:12027:1 gene:F775_27543 transcript:EMT20027 description:""
Sequence
MRWWFSCSFLLLVAAPNLVSGFFTYPVATKPCSEGSEGMAKAGENSFEDEIMESDIELEG
EVVEPDNDPLQKMGDPSVEVSEEMRDKAQLYKKKGVDALSEGKLDEAVEHLTEAILLNPT
SAILYAARAGVFVKMKKPNAAILDAEAALQINPDSAKGYKSRGMAKAMLGKWEDAAHDLH
LAAKLDFDEEISSELKKVEPNVHKIEEHKKRYERLRKERDMKKADLERQRRHAEEVSAAS
AVLKPGDVITIHSSNQLEEIFTAASKLSKLVILYFTATWCGPCRFMGPVYKSLSEQHRNV
IFLKLDIDQQSNIARRWNVSSVPTFSCVINGKEIDKVVGADKTGLERKIAEHGSRKQ
Download sequence
Identical sequences R7WBS2
EMT20027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]