SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EMT20075 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT20075
Domain Number 1 Region: 103-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-18
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT20075
Sequence length 491
Comment pep:novel supercontig:GCA_000347335.1:Scaffold28770:91458:95220:1 gene:F775_18777 transcript:EMT20075 description:""
Sequence
MVMIQGVRSCNLRCRGSGCRGEAKGHGCEVRRARWLGMLMYSSLPVYAILLLLSWPFSLV
PLCASDNQLVAGKLLFPGSVLVYQDGVFALGFFSPSDSTKNHHYVGIRYDDILERTVVWV
SNRAAPITTNLSSANLVVASCSNIVLSDSNGHVLWTTNNNISVNSISVEAVLDNTGNFIL
RSLADSAILWQSFDHSANTLLPGMNLRLSHNTLPLQDLVSWKGQQDPSTGHTGEARCGQT
TSMLVDSTSLPFTRPYIMPTMRMEIDYSGKKLSQFASALTVLSRGMVKDGSPVASHRDAA
RRRCEGAPMETMSNMDIDGDGTRCLGWMGDLIDMENHTQGGENLYVRTKRLQGNMRKITT
LEIVLPVVSSFLIFICVGLIWIYASRGRTYQLSCWNIAWSLRKDGKVMDLIDSSIIKGCS
LVEALRCIHIGLLSVQDDPDAHPLMSWVVVSLDNEDIEIPQPKEPMCFAHRNYRASESHV
HDMSLENPKEC
Download sequence
Identical sequences R7WFM1
EMT20075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]